evergladescamping.net | Everglades hotels | Trail Lakes Campground

Robots.txt Information

Robot	Path	Permission
GoogleBot	/	✔
BingBot	/	✔
BaiduSpider	/	✔
YandexBot	/	✔
User-agent: * Allow: / # Optimization for Google Ads Bot User-agent: AdsBot-Google-Mobile User-agent: AdsBot-Google Disallow: /_api/* Disallow: /_partials* Disallow: /pro-gallery-webapp/v1/galleries/* # Block PetalBot User-agent: PetalBot Disallow: / Sitemap: https://www.evergladescamping.net/sitemap.xml # Auto generated, go to SEO Tools > Robots.txt Editor to change

Meta Tags

Title	Everglades hotels \| Trail Lakes Campground \| United
Description	Trail Lakes Campground allows you to experience the beauty of Everglades camping. We offer camping, cabins, and guided tours. Our goal is to keep the traditions of the Gladesmen alive through
Keywords	Everglades Camping

Server Information

WebSite	evergladescamping.net
Host IP	185.230.63.107
Location	-

Related Websites

                        Site
                        Rank
                    

More to Explore

thecasements.net

streamlite.com

michiganparentdefense.com

adirondackfarmersmarket.com

ormondbeachcelticfestival.com

root4loot.com

crowfarmcapecod.com

saccobowl.com

ausablevalleygrangefarmersmarkets.com

flenix.site

macechasmfarm.com

marjorierwilliams.com

flipbookanimationkit.com

singaporeaircharter.com

evergladescamping.net Valuation

US$10,983,168

Last updated: 2023-05-13 02:23:17

evergladescamping.net has Semrush global rank of 963,684. evergladescamping.net has an estimated worth of US$ 10,983,168, based on its estimated Ads revenue. evergladescamping.net receives approximately 1,267,289 unique visitors each day. Its web server is located in -, with IP address 185.230.63.107. According to SiteAdvisor, evergladescamping.net is safe to visit.

Traffic & Worth Estimates

Purchase/Sale Value	US$10,983,168
Daily Ads Revenue	US$10,139
Monthly Ads Revenue	US$304,150
Yearly Ads Revenue	US$3,649,792
Daily Unique Visitors	84,486
Note: All traffic and earnings values are estimates.

DNS Records

Host	Type	TTL	Data
evergladescamping.net.	A	3599	IP: 185.230.63.107
evergladescamping.net.	A	3599	IP: 185.230.63.171
evergladescamping.net.	A	3599	IP: 185.230.63.186
evergladescamping.net.	NS	86400	NS Record: ns10.wixdns.net.
evergladescamping.net.	NS	86400	NS Record: ns11.wixdns.net.
evergladescamping.net.	MX	3600	MX Record: 0 webmail.evergladescamping.net.

HtmlToTextCheckTime:2023-05-13 02:23:17

top of page Home Camping Cabins Chickee Huts Guided Tours About Contact Florida Everglades Camping Private Camping Camping Options Cabins and Chickees Rates Guided Expeditions Florida State Preserves Big Cypress National Preserve Camping Everglades National Park Camping Everglades Seafood Festival Camping Know Before You Go click here to go camping camping Book cabins Explore guided tours Explore our culture Explore chickee huts Explore contact 1-800-504-6554 40904 Tamiami Trail US 41, Ochopee, FL 34141 View Trail Lakes Campground 2018 WWW.ISLANDMEDIA.GROUP bottom of

HTTP Headers

HTTP/1.1 301 Moved Permanently
Date: Mon, 20 Dec 2021 12:16:13 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.evergladescamping.net/
strict-transport-security: max-age=120
Age: 33079
Server-Timing: cache;desc=hit, varnish;desc=hit, dc;desc=42
X-Seen-By: 6ivkWfREES4Y8b2pOpzk7Owfbs+7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVjfPSLurEWIBzqevPmP0aiw,m0j2EEknGIVUW/liY8BLLg+F4RAy97FgBhKEMuS3Uv0cm7On4dir39PTYYK13tG9,2d58ifebGbosy5xc+FRalpHPxtXnh3xaiMRWXDGsCinhcmdqcQ8PytreTQapoTgeIgm9R/OKYMVuviEb3mQKiw==,2UNV7KOq4oGjA5+PKsX47JLK8RyJpywZMHhcnB0ORXZYgeUJqUXtid+86vZww+nL
Cache-Control: no-cache
X-Wix-Request-Id: 1640002573.537889867881319713
X-Content-Type-Options: nosniff

HTTP/2 200 
alt-svc: h3=":443";ma=86400,h3-29=":443";ma=86400,h3-27=":443";ma=86400
content-type: text/html; charset=UTF-8
link: ; rel=preconnect; crossorigin;,; rel=preconnect;,; rel=preconnect; crossorigin;,; rel=preconnect; crossorigin;,; rel=preconnect;,; rel=preconnect; crossorigin;,
etag: W/"5df53b290c48fafd923fb7f3a77c6455"
content-language: en-US
strict-transport-security: max-age=120
x-wix-request-id: 1640002573.64489049639935829
cache-control: public,max-age=0,must-revalidate
x-content-type-options: nosniff
server: Pepyaka/1.19.0
accept-ranges: bytes
date: Mon, 20 Dec 2021 12:16:13 GMT
age: 46929
x-served-by: cache-ewr18180-EWR
x-cache: MISS
vary: Accept-Encoding
server-timing: cache;desc=hit, varnish;desc=hit_miss, dc;desc=fastly
set-cookie: ssr-caching=cache#desc=hit#varnish=hit_miss#dc#desc=fastly; Max-Age=20; Expires=Sun, 19 Dec 2021 23:14:24 GMT
x-seen-by: roqoaVaG/Y0K4FDXPQbYVA==,gv/XVF9HsGpk8A2KWukUzOwfbs+7qUVAqsIx00yI78k=,GXNXSWFXisshliUcwO20NdOXKPV6XVWjgNrDpn8Zewsa0sM5c8dDUFHeNaFq0qDu,m0j2EEknGIVUW/liY8BLLk4c1TjfDNjZRW4gaj81MvUa0sM5c8dDUFHeNaFq0qDu,2d58ifebGbosy5xc+FRali6OCX+/h1LSipbiNSCz1eTTbPh8DWiKAY7Z+15HGRxGOlXDsrBtATqBTlhWL7dKhQ==,2UNV7KOq4oGjA5+PKsX47LsZt2IrVMtH4UUk1T8GK3UfbJaKSXYQ/lskq2jK6SGP
content-length: 410489

evergladescamping.net Whois Information

Domain Name: EVERGLADESCAMPING.NET
Registry Domain ID: 1629407976_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-11-06T08:57:22Z
Creation Date: 2010-12-08T23:02:25Z
Registry Expiry Date: 2024-12-08T23:02:25Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS10.WIXDNS.NET
Name Server: NS11.WIXDNS.NET
DNSSEC: unsigned
>>> Last update of whois database: 2021-12-24T08:14:58Z <<<

evergladescamping.net valuation and analysis